SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S8AC94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S8AC94
Domain Number 1 Region: 222-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000931
Family Extended AAA-ATPase domain 0.083
Further Details:      
 
Domain Number 2 Region: 663-723
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000392
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S8AC94
Sequence length 727
Comment (tr|A0A1S8AC94|A0A1S8AC94_ROSNE) Uncharacterized protein {ECO:0000313|EMBL:GAW27290.1} KW=Complete proteome; Reference proteome OX=77044 OS=Rosellinia necatrix (White root-rot fungus). GN=SAMD00023353_10100200 OC=Rosellinia.
Sequence
MSFGFSVSDFLQVIQLVNKVRKDFAGAPRELKQISDELRNLENTIRDIDVILDSGDLLPP
QQERLRDITRTCRLTLEYAQELVNNFSTLTSRGGGVGKRAARVWNRLQWDSNEVRDLRDR
IASSVTAFIAFDGVVTRDVVIKIKDGQKQQEERQKQQEEKQKQQEERREQQEILNWLTPI
DYSTQQSDFISRRQQGTGQWLLSSPEYQHWVATKKETLFCPGIPGAGKTIMASIIVDDLL
NRYSTDNSVGIGYIFFNFGRHDEQSIHHLMASLVKQLAQTRPLSRIQNPYQGLKEKNIQP
SSDQVRHTLHSLISEYSRAFIVIDALDECQVQNDCRNKFISEILDLSSKSELNLLVTSRS
IPEITIRFDGVTIKEISASNDDIIRYLDGNMSCLPDFVSRNSALRNEIKDSIIQCVNGMF
LLAQLRLDSLRGKRSPKAIRMALSGSAKGNGPDAYDIAYGDAMARIEGQLPDRVDLARET
LSWIIFAQRPLNTTELTTALGVELGTTEFDQDNLPDLDDIVSSCCGLVTLDEQSDIIRLV
HYTTQEYFERNKSLLFPRAERYIAQKCVTYLSFDAIEPWTPNNSKSKGFMAQGADYKEYL
ATRRIAYPLYTYACLNWGSHAYLSEDYEFCWTFLTTLPKVRASAQQLYNYHGPREEIGVT
NGLHLAAKFGLRSLIKKLAGIYNIDLVDGDGVAPIKHAICRGHGPVVEVLLEIGVTTSLN
NELFLAV
Download sequence
Identical sequences A0A1S8AC94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]