SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S8GGE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S8GGE5
Domain Number 1 Region: 610-665,836-894,922-1026
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000208
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number 2 Region: 682-766
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000275
Family Pseudo ankyrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S8GGE5
Sequence length 1073
Comment (tr|A0A1S8GGE5|A0A1S8GGE5_LEGPN) Uncharacterized protein {ECO:0000313|EMBL:OOK41347.1} KW=Complete proteome OX=1206778 OS=Legionella pneumophila subsp. pneumophila str. Mississauga. GN=LPM_2187 OC=Legionellaceae; Legionella.
Sequence
MIIRELFNWIHNDSATLHLSDQTIERDLIEQEESQAKQAHRVLLGNARLLKYSGSSNTEA
IKELEQHCLFMDYLQLYKQEFVKDRKNTVFLIALKNLLSHPHEEQLRLMPKINELFQILL
RDNKESALSFYDKNKELFRHCTEIQERVTFELLQQKMEADSKLVMTQLDYFNEHLAYQEN
PLGIIALCRNWIGETEKFTALILWLLERKVSVEKILLTNLLQDFLKYHLFTLHSKDSEVS
RLYSLLGHFPEAQELVMAAQKISCGELMFQQYSLDGIFRGKNLPVVSPEIPPLQFSLRKD
NFNALYRTFGQYFLTAGVATATNHSDVAWLDMLRHTLNQPETLKLLPDIINIIAREYSPK
VLKTLAELIAESTAHRLLTLNQSCVFHLLQHKPRLLHDITEENVIEYINLLVRLDTHDQE
IIYQLMALFRVLLKKNHPATKAVFEAILDNLVNHPQLLEDEEFLTQLKKYPDCELLIEER
CENILKQLNFCIAEQTSGLLFGKHNYYIIEDVWLGALRKFAVLQQINPQMKSSFGHKYAL
QARVAEVVFIHQGDLFDLDTFIDALDLPPVTSSGEISPYERALIEILATIDNDLIRKQII
QKLETTPFNRLDWYEREYGNQTVFIKAAKKGNLGLINLLEDKMKPSVLNKALRAAAKNYQ
WETLDHLCSLPGVELRQDEMDDLVVYLAEHGRIESVKKLLKLYDYKPSTELIGTILKKAI
DNDNLQVVMYFCKLPVESPKQAMLDRLFKLAIQLQHWDIVEYLANSKHYSPSQATLEKAF
QQTALAMQHEAVEILGNVEKTPIRAIVIERALLKASKLGHAKVVQSICALPSESLTKQAI
EDALEQAAAEGHLDIVSCLCEPGTTTLKQPGINSGMKIAVQAGKLSVVNYFCSMTGSNKP
TPRLIDQTLVMAVKKGQTAIFIAIHSNHQTPPGKHAIEQSFQLAITAGKLPILDYLCRHE
GYGLNQSKVDQALISAVKSKQLEIVSYLCESLEITPSRKALRIAVSKAISSDQTGLAEYL
RSRSTDKSKLTDTLVDEIDSTSKVGKQLEANGLFKKKKRQTDREPQILFNPAI
Download sequence
Identical sequences A0A1S8GGE5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]