SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S8VN71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S8VN71
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.88e-16
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0025
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000131
Family Cold shock DNA-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S8VN71
Sequence length 219
Comment (tr|A0A1S8VN71|A0A1S8VN71_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:OON03591.1} KW=Complete proteome; Reference proteome OX=1357716 OS=Batrachochytrium salamandrivorans. GN=BSLG_06128 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MFVLSVLQDIVRVLPKDFFKDKEEAIIDEINLKYANKVLHNVGLCIAVYDLTEASDPVVH
ACQDGSYQCTVEFRMVVFRPFKGEILEGKIKDCSQTTGVRVTMSFFSDIIIPPSFLMPGS
EYDTGEGLWVWKYEGNDLFMDREEPIRFRVENEAFVDVGPVKEVKSGPVGNKTAAPTGGN
AGNSGTDEQHREPHRDPPYTIVGSIAESALGLKSWWDGQ
Download sequence
Identical sequences A0A1S8VN71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]