SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S8VUJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S8VUJ0
Domain Number 1 Region: 253-295,340-470,500-528
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000333
Family Ankyrin repeat 0.0086
Further Details:      
 
Domain Number 2 Region: 106-123,171-182,225-324
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000209
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S8VUJ0
Sequence length 600
Comment (tr|A0A1S8VUJ0|A0A1S8VUJ0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:OON05842.1} KW=Complete proteome; Reference proteome OX=1357716 OS=Batrachochytrium salamandrivorans. GN=BSLG_04359 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MGAVCFNDKSQIYKHAVHSIPHRISQFYHHPVGLLLLTAVVIVTIIIIIMSTRQSKRFLG
SADLMDMIYCLPIELRNQIYKEAGPLTRYFHNELIHPISRPTASQIMVECFKTNNLDALE
KGLCPQIELSFETMFLSTSKMWAAACSLPRVSGCEADMASKHSVHCIFPISSDGCEVRHI
DKHSMLGMTAMLCMPVIDPLTLRLLNDALDVAMTSPQSLLDPQLASKLVECASGLGRIDI
VKVALAHVIRPSWHAFLFAGLHGHLEVLKMLCDHGSQQCLTAYGAVAGGHVDIAEHIRKS
GSLHMVTESAVQFALGSGRVDTVWWMFREPSYWTHSAFGDIKNMSATMGNMDMLLFTIEH
NIGGPLTSDGANGAAKNGHLSILKWIYSHYENMSSKVALILAAEHGHFETFVWLCENTHW
SLDEVDICQASRNGHLWIVEYYAKCISTGSLDQVLVSALSGGRIELAELLIETGRTTPNA
SMMLPIATAGNVAGVKWLHQKIDGTYSSECIEMACRNNQKELVLCLIDTCHIRITPEIRE
EAAINGSIELVQSLYQRDPLSDWSAARLASDSNQDMDVATWLEEQITSAMLTMNIEENKA
Download sequence
Identical sequences A0A1S8VUJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]