SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S8W8R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S8W8R7
Domain Number 1 Region: 441-571
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000144
Family Pseudo ankyrin repeat 0.017
Further Details:      
 
Domain Number 2 Region: 204-318
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000226
Family Ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S8W8R7
Sequence length 639
Comment (tr|A0A1S8W8R7|A0A1S8W8R7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:OON10844.1} KW=Complete proteome; Reference proteome OX=1357716 OS=Batrachochytrium salamandrivorans. GN=BSLG_00442 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MGADDLMDAVAALPLEIRGYIYNYTCLRTRLQHQQYAYGSPMTLMTRSLLWVECLSLQAA
SLVRLLPSHAVSWELLMVHATCSPALLREVKKRLKRMRAESTLVSIADGPDTCSAVAVLD
GGRSSSAVRPITALQAYRLIRKGHGIALVRLIEHASHIPHLQRRHEPYWPFLQPQQLLHL
QQLFGKSMLVDYPLPSDTPVQRSLLLMVAAATGNLAVVNDILLQDIVVGAVCSAIHLASI
NAHMNVLHRLCRNKNMRPPSIAGAVRGGHLSVVQYLCNRYPAAPAVDRYWIEYAVMLDRR
DILEWVVAHMDSLPSSLSNTNINPGILTIVNSQDDLSFNTKDTSLIISNAKVMQDLHFLA
LKHNNIAILGHLPPHVLCGPVSVDQLITAISNDVSLLRLVCTSNINATWCPEIMDAAAAK
GCLAAVEFLHFNRTEGCTTVAMDLAAAKGHLSVVQFLHLNRTEGCTTDALDNAVINKCTG
TIQFLVANRTEGCTAAAMDSAAATGRLDIVTLLHTLPNTRCTTNAVDLAAANGHLDIVEF
LMVNRSERCTSAAVNKAIAFRHFDIVWYLLESSAPLTTETITELLKCDQLDCVQVLYSST
LHPRPDWASLRQYALQRGSFKVSDWLKKQLRKLPKENGI
Download sequence
Identical sequences A0A1S8W8R7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]