SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S9YZW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1S9YZW1
Domain Number - Region: 11-108
Classification Level Classification E-value
Superfamily Proteasome activator 0.0225
Family Proteasome activator 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S9YZW1
Sequence length 177
Comment (tr|A0A1S9YZW1|A0A1S9YZW1_BACCE) Uncharacterized protein {ECO:0000313|EMBL:OOR76759.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BLX06_02365 OC=Bacillus cereus group.
Sequence
MPHYIVPVQVHPKAIDALMKEAEIKILSLTPIMQKDDNTIISSEIAIQLKDNLYLNVSVA
RSEMKFEDEVEHLQVIVERNVPNITDGNPKNILVFEKFLRIRGNVQCELLVEEEKYTDLS
SKKVLYTSECGTGILLKNDEETVLITCNEFCTILVTKDQEIINDILNKRYNFTRLKG
Download sequence
Identical sequences A0A1Q9KN10 A0A1S9YZW1
WP_002197523.1.14006 WP_002197523.1.20651 WP_002197523.1.28237 WP_002197523.1.33201 WP_002197523.1.4964 WP_002197523.1.5025 WP_002197523.1.59058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]