SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T1B762 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T1B762
Domain Number 1 Region: 2-270
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 6.93e-65
Family Hypothetical protein YwqG 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1T1B762
Sequence length 270
Comment (tr|A0A1T1B762|A0A1T1B762_9DEIO) Uncharacterized protein {ECO:0000313|EMBL:OOV12065.1} KW=Complete proteome; Reference proteome OX=1938608 OS=Deinococcus sp. LM3. GN=BXU09_18990 OC=Deinococcaceae; Deinococcus.
Sequence
MRLPRALSPYRGVLEATVRPSVRLSGVRAPARPWSSKLGGVPYRLLGTDAPLSRDGHPLT
FLAQLNLAEFPALPGFPAQGIVQFFIRDDDYYGANFEGSLDATSLGDAANFRVLYHPEVV
QDTARLELAAPAYQPDPDGNGLPHDPAQEFVLRGELMSGPVTGDDRLFEHLVGQSLWQLG
GEMEEDGEADPLTDRYARLAGAGHKLGGYPNFTQQDPRRPEDPHVLLFQLDSDDDLDMMW
GDVGIANFFIPPDDLARGDFSRVAYHWDCC
Download sequence
Identical sequences A0A1T1B762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]