SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T2ATY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T2ATY0
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily YccV-like 8.5e-36
Family YccV-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1T2ATY0
Sequence length 108
Comment (tr|A0A1T2ATY0|A0A1T2ATY0_9RHOB) DNA-binding protein {ECO:0000313|EMBL:OOY13679.1} OX=1915077 OS=Thioclava marina. GN=BMG00_07920 OC=Rhodobacteraceae; Thioclava.
Sequence
MYATRAKYHIGQVVRHRKHPFRGVVFDVDAIFSNSQDWYDAIPEDARPPKNQPFYHLLAE
NDESYYVAYVSEQNLVPDWSGEPVSHPDLPDLFGEFGNGTYSLQFQLN
Download sequence
Identical sequences A0A1T2ATY0 A0A1T2C3D5
WP_078526177.1.18201 WP_078526177.1.98709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]