SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T3CLK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3CLK1
Domain Number 1 Region: 30-210
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00000000000000916
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0015
Further Details:      
 
Domain Number 2 Region: 391-477
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000051
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1T3CLK1
Sequence length 589
Comment (tr|A0A1T3CLK1|A0A1T3CLK1_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:OPB41964.1} KW=Complete proteome OX=1491466 OS=Trichoderma guizhouense. GN=A0O28_0030810 OC=Trichoderma.
Sequence
MQSQSHQSPRPSATDMMACFSLREDSLKSRPLRLLITATGTRHSSWAQPLVVRLSKDRRI
EMRAVVDDPSPRLNQLIITIQNTPIAQEPIGPEDVSSKHTGLNIHDLVEWADLLVCVPLD
IRKIETLLVGGGDTFLDDLLRSWNEAQKGCIMVPGMDDSAWLSPLVQQQLGEVQREWPCI
RVMQPILWHYEDAAHPQQATNWSGFRDLLDLIQNQADLLNLGRDGEATGRAVAMSELHAT
TLPGLPFELWSKVLSFTGDWELAAALGINTSLPVPTEWNVQVEDLSDPLLIYSHELERTV
LTCNTAAICRKLSQAPDDFQILPVLVVKLITRFALVKVLAYLESNHPQLFKAFDGAFLPT
KASAYYPQVRVLDYWKNSPHFQNRHVYDTEAIDGACKNGHVHILQWWKQSGLPLLYTKVS
LEQASGNGLISVLEWWRDAVALDHNIVLKTGRSLLWAATNGQADVLRWWHASGIEMGYSG
GVAFTASRWGHVHVLETWRKLQGDDNVLFDAEEVIYIATARQHVEVLEWWRQFARGMLDG
MNGRGVKVKFRTRRIQEAVESAPKSQEWWFRYRLSIGKDQDWWPSFLAL
Download sequence
Identical sequences A0A1T3CLK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]