SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T3J777 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3J777
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.000000034
Family PG0164-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1T3J777
Sequence length 173
Comment (tr|A0A1T3J777|A0A1T3J777_ELIME) Uncharacterized protein {ECO:0000313|EMBL:OOH97952.1} KW=Complete proteome OX=238 OS=Elizabethkingia meningoseptica (Chryseobacterium meningosepticum). GN=BMF97_01405 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MGTNKTYNFKAELDRIGINPFVFLPAPVLEALLQHEKKYKGKIPVKGSVNTIDYRQTLVK
YSGEWRLYINTSMLKNSPKRIGELLDIHIEIDEEERKIEAHPKLLTALEENPAALEIFNQ
LRPSLRNEIIKYISYLKTEQSVEKNIEKAIQFLLGNERFVGREKPEIKQIKNP
Download sequence
Identical sequences A0A1T3J777
WP_070904820.1.101133 WP_070904820.1.14081 WP_070904820.1.22355 WP_070904820.1.29032 WP_070904820.1.39567 WP_070904820.1.54869 WP_070904820.1.76836 WP_070904820.1.83023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]