SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T3V9A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3V9A3
Domain Number 1 Region: 15-250
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 3.01e-61
Family Hypothetical protein YwqG 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1T3V9A3
Sequence length 250
Comment (tr|A0A1T3V9A3|A0A1T3V9A3_BACAN) Cytoplasmic protein {ECO:0000313|EMBL:OPD60048.1} KW=Complete proteome OX=1392 OS=Bacillus anthracis. GN=BVG01_05740 OC=Bacillus cereus group.
Sequence
MNKQIEVLIDKYGLTHLKEELINTVFPCVKVVPKQEETVAIGSSKMGGIPDLPFAFEYPT
HKGNPLQFIAQFNLKDLQHVGMDHNLPKTGMLYFFTIENYFEEDVSPTEAGRVLYYDVPV
EQLRRADELQTNYNQCAITFELTYKLPELFIEDEADSDRFLQLLEELIPDNYDNHQMFGE
PFSVQEEVLYETGEYMGVDPQKMTLLFQIDSDTKNCNMMWGDLGMLYFCIGNEDLKNRRF
ENACCVLQTC
Download sequence
Identical sequences A0A150B7C6 A0A1T3V9A3 A0A243BG21
WP_017561775.1.101931 WP_017561775.1.11387 WP_017561775.1.14882 WP_017561775.1.66357 WP_017561775.1.7856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]