SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U6Y631 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1U6Y631
Domain Number - Region: 118-144
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0157
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U6Y631
Sequence length 359
Comment (tr|A0A1U6Y631|A0A1U6Y631_AERHY) Uncharacterized protein {ECO:0000313|EMBL:AJE38615.1} KW=Complete proteome OX=1419584 OS=Aeromonas hydrophila J-1. GN=V469_10710 OC=Aeromonadaceae; Aeromonas.
Sequence
MPAKLISSGKSDDGMFDEIADKAKEAAIRLGNTIRGQFAPYEIEVEGGVKALQYPRQENG
VWDNTPMMLFTIYKDHGISNAKLFEQNSSALRQTTVEQTQSIIMLPMPLNGLTDTVNNSI
SDSNPDFLQYLIANGIDAFANGKDMSQSAKDAFGSVVNTVASEASKNVKQFTQQYNTSMG
ANKTITPNRGHHGYRGTDANSYTFNYRFYPKNRAELKEIGMIIQEFKLASVPNQTGSGNA
GNGYSILESPPLCSVKEIVINNTGKVKRFTPRFLTGVAQIKGVKVTTGSDSNGYPVFDGT
AGDPTVIDLEITVQDLLYKTREQIKAGFDDNFAMQTVAPNRAKDIFKSTWVGRENNKGG
Download sequence
Identical sequences A0A1U6Y631
WP_016350764.1.11585 WP_016350764.1.17591 WP_016350764.1.17828 WP_016350764.1.1904 WP_016350764.1.2747 WP_016350764.1.34398 WP_016350764.1.4153 WP_016350764.1.51862 WP_016350764.1.5367 WP_016350764.1.56245 WP_016350764.1.62064 WP_016350764.1.62601 WP_016350764.1.62729 WP_016350764.1.6571 WP_016350764.1.9133 WP_016350764.1.93440 WP_016350764.1.94363 gi|507521906|ref|YP_008043520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]