SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EZA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1U7EZA5
Domain Number - Region: 302-347
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000409
Family Z-DNA binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EZA5
Sequence length 371
Comment (tr|A0A1U7EZA5|A0A1U7EZA5_NATPD) Probable transmembrane glycoprotein / HTH domain protein {ECO:0000313|EMBL:CAI50605.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_5028A OC=Natronomonas.
Sequence
MRCRVPVLVCALLLCLVAAGAAPALAQPDAEETHFEAQLQDDGDAEWTIAVSVPFTNETD
RDRFDSFAEAFEAGREDLDPGHGAFQRAAAEAERAADREMAVTAPRRDSAIVEDENGTEY
GELRVTFVWESFARIDDNGTLYVDDAFNTTNGPWLPGLEDDQSLTIAAPPGYAGPTTSPI
GAEEGDLHWEGPETFGPGYFTIVYPQSSPGPAPDVGISTMLLWGALLLSGAALLLGLYLL
VARHWPPTGRRSGSGSEETPPDASADSPPPGGASAEPTSDDAAGSDAETADDEIDMELLS
DEERVEYLLEQNGGRMKQANIVKETGWSNAKVSQLLSSMADEDRVDKLRIGRENLISLPG
EGIDDIDTNDK
Download sequence
Identical sequences A0A1U7EZA5
348780.NP5028A gi|76803142|ref|YP_331237.1| WP_011324215.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]