SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7H6X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7H6X2
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily XisI-like 1.83e-47
Family XisI-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7H6X2
Sequence length 111
Comment (tr|A0A1U7H6X2|A0A1U7H6X2_9NOSO) XisI protein {ECO:0000313|EMBL:OKH17555.1} KW=Complete proteome; Reference proteome OX=1357508 OS=Nostoc calcicola FACHB-389. GN=FACHB389_34510 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MDTLDTYRQIIQKILKEYAQLPYAYGELERQLIIDQTANHYLLLTLGWENNQRVHGCLVH
IDIINEKIWIQRDGTEYGIANELVNAGIPKNQIVLAFQPADIRHYTEFAVN
Download sequence
Identical sequences A0A1U7H6X2
WP_073645251.1.62728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]