SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7KCU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7KCU0
Domain Number 1 Region: 24-59
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.00000000361
Family Myosin S1 fragment, N-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7KCU0
Sequence length 71
Comment (tr|A0A1U7KCU0|A0A1U7KCU0_9APHY) Uncharacterized protein {ECO:0000313|EMBL:OKY59688.1} KW=Complete proteome; Reference proteome OX=98765 OS=Phlebia centrifuga. GN=PHLCEN_6784 OC=Agaricomycetes; Polyporales; Meruliaceae; Phlebia.
Sequence
MPAPRPSQSAEVARAAALQAEFNEKKWVWVPDDKDGYLAGWVTKEEDEMGEVIMAAGGEA
SLPKAFIHIGG
Download sequence
Identical sequences A0A1U7KCU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]