SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7Q8G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7Q8G2
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 9.81e-43
Family eIF-2-alpha, C-terminal domain 0.000000622
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.57e-33
Family eIF2alpha middle domain-like 0.0000021
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.43e-17
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7Q8G2
Sequence length 315
Comment (tr|A0A1U7Q8G2|A0A1U7Q8G2_MESAU) eukaryotic translation initiation factor 2 subunit 1 {ECO:0000313|RefSeq:XP_005072801.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Eif2s1 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKKPGYGAYDAFKHAVSDPSILDSLDLNENEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELTRQMERLERENAEV
DGDDDTEEMEAKAED
Download sequence
Identical sequences A0A1U7Q8G2 G3H1M4
XP_003498319.1.69978 XP_005072801.1.91757 XP_007634970.1.28591 XP_016825544.1.69978 XP_016825546.1.69978 XP_016828536.1.28591 XP_016828537.1.28591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]