SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7QIN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7QIN8
Domain Number 1 Region: 194-316
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 3.14e-59
Family USP8 interacting domain 0.000000244
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily RING/U-box 2.95e-21
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 78-142
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000124
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7QIN8
Sequence length 317
Comment (tr|A0A1U7QIN8|A0A1U7QIN8_MESAU) E3 ubiquitin-protein ligase NRDP1 {ECO:0000313|RefSeq:XP_005079773.1, ECO:0000313|RefSeq:XP_012975787.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Rnf41 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVV
TVAHLRPVPRIMRNMLSKLQISCDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGC
GLEMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAI
RSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPA
SIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDM
VQEPGLVMIFAHGVEEI
Download sequence
Identical sequences A0A1U7QIN8
XP_005079773.1.91757 XP_012975787.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]