SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7QYE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7QYE2
Domain Number 1 Region: 371-559
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-37
Family Nucleotide and nucleoside kinases 0.00000121
Further Details:      
 
Domain Number 2 Region: 130-318
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.64e-32
Family Nucleotide and nucleoside kinases 0.0000502
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7QYE2
Sequence length 561
Comment (tr|A0A1U7QYE2|A0A1U7QYE2_MESAU) adenylate kinase isoenzyme 5 {ECO:0000313|RefSeq:XP_005083686.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Ak5 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MNTNDAKEYLARRDIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFV
SQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSASSNRKW
SLIAKIITNGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLV
VFLACANQRLRERLAKRAEQQGRPDDNLKATQRRLVNFKQNAAPLVKYFQEKGLIMTFDA
DRDEDAVFYDISVAVDNKLFANKEAATDSGDLDPLMFDAGEIVDTGSDYDDQGDDQLNVF
GEDTRGGLMEDLRKCKIIFLMGGPGSGKGTQCEKLAEKYGFTQLSTGELLRQELASESER
SRLIRDIMERGDLVPSGVILELLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGDPH
LVICMDCSADTMTNRLLQRSQSSQRGEDTAKTIAKRLEAYHRASIPVIAYYETKTQLRKV
NAEGTPDQVFLQLCTAIDSVF
Download sequence
Identical sequences A0A1U7QYE2
XP_005083686.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]