SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7RVA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7RVA4
Domain Number 1 Region: 269-469
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.18e-34
Family Nucleotide and nucleoside kinases 0.00025
Further Details:      
 
Domain Number 2 Region: 58-174,200-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-21
Family Nucleotide and nucleoside kinases 0.0016
Further Details:      
 
Domain Number 3 Region: 392-420
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000628
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0026
Further Details:      
 
Domain Number 4 Region: 14-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0065
Further Details:      
 
Domain Number 5 Region: 177-205
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000654
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7RVA4
Sequence length 478
Comment (tr|A0A1U7RVA4|A0A1U7RVA4_ALLSI) adenylate kinase 8 {ECO:0000313|RefSeq:XP_006029862.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=AK8 OC=Alligator.
Sequence
MDATSRPLRVPPEMGPYAEKHGLFQLLQNMLEKLLIHKPDDPIDFMITHLKQDNDDVPRI
CIVGPPASGKTTIAMWLCKQLDAVRVSPETLLLEELLELTKEVRAYKEREQEIPNALWTN
LIQERLSNVDCIKRGWVLEGFPENREQAWMLQSAGIAPRHVVVLYAPDIVLIERNLGKRV
DPFTEEVYHTTFDWPSDPLVQQRLVEPEGVSEQETSKKLLDYHRNFPGIFQTFHKILKSI
NADQPCADVFSQALTYVQTRHRSAAPFTPRILFCGPPGSGKSLQAALIAQKYGIVNICCG
QLLKEAVADKTKLGELVKPYFDNGCPVPDNIVLKILADRLNRLDCMTSGWVLHGFPRDLD
QAEQLERIRMIPNRVFFLNLPYESIMERLAQRRIDPATGERYHITYKPAPSPDIQARLRQ
NPKDLEGKIEMRLEIYYRDIKDLEEFYENAFYINADQDPHVVFEYIESCIIKPLPQKS
Download sequence
Identical sequences A0A1U7RVA4
XP_006029862.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]