SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7RYT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7RYT4
Domain Number 1 Region: 61-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.45e-54
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 289-328
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000484
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7RYT4
Sequence length 329
Comment (tr|A0A1U7RYT4|A0A1U7RYT4_ALLSI) ankyrin repeat and SOCS box protein 5 {ECO:0000313|RefSeq:XP_006028240.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=ASB5 OC=Alligator.
Sequence
MTVIEESRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VPQGQGSWADRSPLHEAASQGRLLSLKTLLSQGYNVDILTIDQVTPLHEACLGDHVGCAR
ILLEAGANVNATTIDGVTPLFNACSRGSASCAELLLEYGAKAQWESCLPSPIHEAASRGH
SECLEVLISWGIDVDQELPHLGTPLYVACVSQQIHCIRKLLYAGANVQKGKHLDTPLHAA
AQQPSAEIVNLLLEFGADINARNTDFERPIDLAPPRSLVERTLLLYEATPCSLCQLCRLC
IRNYIGRTRLHLVPQLQLPTILKNFLQYR
Download sequence
Identical sequences A0A1U7RYT4
XP_006028240.1.24877 XP_006275427.1.47583 XP_019336907.1.47583 XP_019336908.1.47583 XP_019377352.1.87953 XP_019377353.1.87953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]