SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7S7F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7S7F8
Domain Number 1 Region: 6-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7S7F8
Sequence length 211
Comment (tr|A0A1U7S7F8|A0A1U7S7F8_ALLSI) ropporin-1A {ECO:0000313|RefSeq:XP_006030527.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=ROPN1 OC=Alligator.
Sequence
MPYTDTHISIPPQLPEILKQYTKGAIRTQPPDLLQWSADYFTAVARGDIPPVRERMERTP
LSNWADLTPEILKVLHQRVGGRLIVHADELAHLWKVLNLPTDLFESVMNVGHFTEEVEWL
KFLALSSSSLGVNITKTLKIICEVLSNDDSGPARIPFSTFQFLYTYIAEVDGEISLSHVN
RMLNYIEQEIIGPDGLIKVNDFTRNPQVKLE
Download sequence
Identical sequences A0A1U7S7F8
XP_006030527.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]