SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7TDE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7TDE3
Domain Number 1 Region: 6-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000188
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7TDE3
Sequence length 212
Comment (tr|A0A1U7TDE3|A0A1U7TDE3_TARSY) ropporin-1 {ECO:0000313|RefSeq:XP_008054423.1, ECO:0000313|RefSeq:XP_008054424.1} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=LOC103258565 OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MPQTDKQICIPPELPELLKQFTKDAIRTQPQDLIQWACDYFGAMARGEILPVREPSERVT
LSNWAELTPELLKILHSRVAGRLIIHAEELAQMWKVLNLPKDLFNSVMNVGRFTEEIEWL
KFLALACSCLGVTIAKTLKIVCEVLSCDHDSGPARIPFSTFQFLYTYIAEMDGEISASHV
SRMLNYIEQEVIGPDGLIKVNDFTQNPRVRLE
Download sequence
Identical sequences A0A1U7TDE3
XP_008054423.1.4292 XP_008054424.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]