SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7TP90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7TP90
Domain Number 1 Region: 11-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000562
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7TP90
Sequence length 66
Comment (tr|A0A1U7TP90|A0A1U7TP90_TARSY) RIIa domain-containing protein 1 {ECO:0000313|RefSeq:XP_008059625.1} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=RIIAD1 OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MEIQTRIANEKYLRAHKEVELLISGFFREIFLQRPDNILEFAADYFTDPRLPNKIHMQLI
KDKKAA
Download sequence
Identical sequences A0A1U7TP90
XP_008059625.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]