SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7U3T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7U3T9
Domain Number 1 Region: 48-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.02e-45
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 276-335
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000524
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 
Domain Number 3 Region: 246-292,384-420
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000017
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7U3T9
Sequence length 474
Comment (tr|A0A1U7U3T9|A0A1U7U3T9_TARSY) ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 isoform X1 {ECO:0000313|RefSeq:XP_008059947.1} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=ASZ1 OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MAGALCSPAVAGGGESSESEDDGWEIGYLDRPSQKLKGPLPVEEKNEAFKKALSTGDVAL
VQELLNSGVSVNSSFRYGWSPLMYAASVANADLVRVLLDKGANASFNKDKQTILITACSA
RGSEEQVLKCVELLLSRNADPNVACSRLMTPVMYAARDGRPQVVALLVAHGAEVNTQDEN
GYTALTWAARQGHKNVVLKLLELGANKILQTKDGKTPSEIAKRNKHHEIFTLLSLTLTPL
EGKLQQLTKEKTICKLLATDSDKEKDHIFSSCTALGDLEIFLHGLGLEHLTDLLKERGIT
LRHLLTMRKDEFIKNGITHKDQQKILAAVKELEVEEIKFGELPEVAKLEISGDEFLNFLL
KLNKQCGHLITAVQNIITELPVNSHKIVLEWASPQNFTSVCEELVSNVEDLNEEVCKLKD
LIQKLQNERENDPTHIPLMEEVSTWNSRILKRTAITVCGLGFLLFICKLTFQRK
Download sequence
Identical sequences A0A1U7U3T9
XP_008059947.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]