SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7U9V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7U9V0
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.0000000000000747
Family Interleukin 8-like chemokines 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7U9V0
Sequence length 106
Comment (tr|A0A1U7U9V0|A0A1U7U9V0_TARSY) stromal cell-derived factor 1-like {ECO:0000313|RefSeq:XP_008065518.1} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=LOC103269764 OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MPFQDCTGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCID
PKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN
Download sequence
Identical sequences A0A1U7U9V0
XP_008065518.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]