SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7WYZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7WYZ2
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily MAL13P1.257-like 1.83e-18
Family MAL13P1.257-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7WYZ2
Sequence length 161
Comment (tr|A0A1U7WYZ2|A0A1U7WYZ2_NICSY) UPF0587 protein CG4646-like {ECO:0000313|RefSeq:XP_009783828.1} KW=Complete proteome; Reference proteome OX=4096 OS=Nicotiana sylvestris (Wood tobacco) (South American tobacco). GN=LOC104232347 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MKYLLEITANLTHIVEMTPEDGVDDPNMPYFFRLKCENCDIVSKEQCVYPSEVVYHKRKR
VNHVIKCKGCKRVGTVKLVPGSESVFTAAAAAGGIYMPLMMFECEGLVPQQYAFNGGWKL
TTDTGEDIMVNLVNGYFAGSEDEYGDNQPVVANVRGRFTPQ
Download sequence
Identical sequences A0A1S3ZTZ7 A0A1U7WYZ2
XP_009783828.1.57364 XP_016467885.1.3737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]