SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7X3R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7X3R8
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 5.23e-58
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000000456
Further Details:      
 
Domain Number 2 Region: 278-420
Classification Level Classification E-value
Superfamily L30e-like 2.83e-50
Family ERF1/Dom34 C-terminal domain-like 0.00000581
Further Details:      
 
Domain Number 3 Region: 142-276
Classification Level Classification E-value
Superfamily Translational machinery components 9.81e-47
Family ERF1/Dom34 middle domain-like 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7X3R8
Sequence length 437
Comment (tr|A0A1U7X3R8|A0A1U7X3R8_NICSY) eukaryotic peptide chain release factor subunit 1-3 {ECO:0000313|RefSeq:XP_009781509.1, ECO:0000313|RefSeq:XP_009781510.1} KW=Complete proteome; Reference proteome OX=4096 OS=Nicotiana sylvestris (Wood tobacco) (South American tobacco). GN=LOC104230411 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MSDGQESDKNIEIWKIKKLIKALEAARGNGTSMISLIMPPRDQVSRVTKMLGDEFGTASN
IKSRVNRQSVLGAITSAQQRLKLYNKVPPNGLVLYTGTIVTDDGKEKKVTIDFEPFKPIN
ASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFSVDLPKKHG
RGGQSALRFARLRMEKRHNYVRKTAELATQFYINPATSQPNVSGLILAGSADFKTELSQS
DMFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILANVKFIQEKKLIGKYFEEISQDTG
KYVFGVDDTLKVLEMGAIETLIVWENLDITRYVLKNSSSGETIIKHLNKEQDADQSNFRD
PATNAELEVQDKLSLLEWFANEYRRFGCSLEFVTNKSQEGSQFCRGFGGIGGILRYQLDV
RAFDELSDDGEVYEDSD
Download sequence
Identical sequences A0A1S3YAB0 A0A1U7X3R8
NbS00042041g0002.1 XP_009630489.1.42874 XP_009630490.1.42874 XP_009781509.1.57364 XP_009781510.1.57364 XP_016448947.1.3737 XP_016448948.1.3737 XP_019266024.1.74238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]