SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8BGR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8BGR1
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000194
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8BGR1
Sequence length 419
Comment (tr|A0A1U8BGR1|A0A1U8BGR1_MESAU) uncharacterized protein C8orf34 homolog isoform X3 {ECO:0000313|RefSeq:XP_012966417.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=LOC101831198 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MASRQQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLS
GSAALWAESETSEPKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPSPDSKSCIAI
SDELDKETVAFNSSLLRPRVIGEWIGRAENDADPLAAEMLQPPIPRSKNDPWDSEESSSS
PAGSLKMEPKTKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSAIEEDIDNEDDAMELLE
DLDDLRMEGVTTLVLSGSKFNQGRPTHTVEPQAKVTLNICSRCARLQGDNLMERTEDTMQ
IFHSPEERIPDSLDSLPGTEETLMEEGEDFEKPSKLTEPGEDSSGGHCLKSYMEEDESLK
QLQVVHQPWLLPSDTESEGFEAEQDKRSADLLCVPCTSCPTLIYSGLSVKQAKDVSSGP
Download sequence
Identical sequences A0A1U8BGR1
XP_012966417.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]