SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8BTY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8BTY2
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000055
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000116
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8BTY2
Sequence length 243
Comment (tr|A0A1U8BTY2|A0A1U8BTY2_MESAU) R-spondin-2 {ECO:0000313|RefSeq:XP_012970716.1, ECO:0000313|RefSeq:XP_012970717.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Rspo2 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MRFCLFSFALIILNCMDYSQCQGNRWRRNKRASYVSNPTCKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGFYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKAGFYLH
RGRCFDECPDGFAPLDETMECVEGCEVGHWSEWGPCSRNNRTCGFKWGLETRTRQIVKKP
AKDTIPCPTIAESRRCKMAVRHCPGGKRTPKAKEKRNKKKRRKLTERAQEQHSAFLATDR
ANQ
Download sequence
Identical sequences A0A1U8BTY2
XP_012970716.1.91757 XP_012970717.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]