SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8C2M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8C2M4
Domain Number 1 Region: 76-211
Classification Level Classification E-value
Superfamily Stathmin 5.23e-57
Family Stathmin 0.000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8C2M4
Sequence length 216
Comment (tr|A0A1U8C2M4|A0A1U8C2M4_MESAU) stathmin-4 isoform X1 {ECO:0000313|RefSeq:XP_012972655.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Stmn4 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MTLAAYKEKMKELPLVSLFCSCFLSDSLNKSSYKYEGWCGRQCRRKGQSQRKGSADWRER
REQADTVDLNWCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEE
IQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNK
ENREAHLAAMLERLQEKDKHAEEVRKNKELKEEASR
Download sequence
Identical sequences A0A1U8C2M4
XP_005355540.1.66349 XP_012972655.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]