SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8CEW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8CEW0
Domain Number 1 Region: 27-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-20
Family KRAB domain (Kruppel-associated box) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U8CEW0
Sequence length 120
Comment (tr|A0A1U8CEW0|A0A1U8CEW0_MESAU) zinc finger protein 846-like {ECO:0000313|RefSeq:XP_012974124.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=LOC101831865 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MPEGGYFYKDQYFIKLTELEIQVYNVNQNAVTYDDVHIDFSWEEWTLLDPSQKNLYEDVM
LETYRNLTAIEMKEVKLERSLLYILNVLKPLHFKGIKELMLERNPLNISTVAKPMQITKV
Download sequence
Identical sequences A0A1U8CEW0
XP_012974124.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]