SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8DRH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8DRH3
Domain Number 1 Region: 117-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-34
Family cAMP-binding domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 246-370
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-32
Family cAMP-binding domain 0.000000777
Further Details:      
 
Domain Number 3 Region: 16-60
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000000204
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U8DRH3
Sequence length 379
Comment (tr|A0A1U8DRH3|A0A1U8DRH3_ALLSI) cAMP-dependent protein kinase type I-beta regulatory subunit {ECO:0000313|RefSeq:XP_014380314.1, ECO:0000313|RefSeq:XP_014380315.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=PRKAR1B OC=Alligator.
Sequence
MAAAASSCTGEEDESLKGCELYVQKHNIQQMCIVNLCIAKPDRPMKFLREHFEKLEKEEC
KQILARQKSNSQSDSHDDEISPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDY
KTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEV
DVYVNGEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRK
RKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTASV
LQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPC
SEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A1U8DRH3
XP_014380314.1.24877 XP_014380315.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]