SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8E8K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8E8K6
Domain Number 1 Region: 115-197
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.96e-28
Family SWIB/MDM2 domain 0.0013
Further Details:      
 
Domain Number 2 Region: 234-315
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 7.52e-25
Family SWIB/MDM2 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 3-55
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000000000458
Family DEK C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8E8K6
Sequence length 315
Comment (tr|A0A1U8E8K6|A0A1U8E8K6_CAPAN) upstream activation factor subunit spp27-like isoform X2 {ECO:0000313|RefSeq:XP_016539640.1} KW=Complete proteome OX=4072 OS=Capsicum annuum (Bell pepper). GN=LOC107840320 OC=Capsiceae; Capsicum.
Sequence
MVSDSVLIERLRQILTVSDLETATAGTVRRMLEEEFGVDLLDRKAFIRDQIDVFLRIHVQ
ETPNDDAQEVEDVKEEENGDSCSEGEEELVENDNSNDTGSKKKARSEKVNGEEKRKGGFN
KPCALSPQLQKLVGEPELGRPEVVKKIWAYIREKKLQNPQNKRKILCDDVLSGIFRAKAI
DMFQMNKVLSKHIWPIDEKDAAEVKSSVKRTQKQGREEALDEPKQKEKRQKGGGSGFLAP
VRLSDALGKFFGNGENSLPRAEVIKRIWQYIKENELQDPSNKKTIICDERLKELFQVDSF
HGFTVSKLLTAHFIK
Download sequence
Identical sequences A0A1U8E8K6
XP_016539640.1.72714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]