SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8F4Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8F4Z8
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 4.97e-58
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000000753
Further Details:      
 
Domain Number 2 Region: 278-420
Classification Level Classification E-value
Superfamily L30e-like 2.36e-51
Family ERF1/Dom34 C-terminal domain-like 0.00000666
Further Details:      
 
Domain Number 3 Region: 142-276
Classification Level Classification E-value
Superfamily Translational machinery components 3.47e-47
Family ERF1/Dom34 middle domain-like 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U8F4Z8
Sequence length 437
Comment (tr|A0A1U8F4Z8|A0A1U8F4Z8_CAPAN) eukaryotic peptide chain release factor subunit 1-3-like {ECO:0000313|RefSeq:XP_016550760.1, ECO:0000313|RefSeq:XP_016550761.1} KW=Complete proteome OX=4072 OS=Capsicum annuum (Bell pepper). GN=LOC107850618 OC=Capsiceae; Capsicum.
Sequence
MADGQENDKNIEIWKMKKLIKALESARGNGTSMISLIIPPGDQISRITKMLAEEYGTASN
IKSRVNRQSVLGAITSAQQRLKLYNKVPPNGLVLYTGTIVTEDGKEKKVTFDLTPFKPIN
ASLYLCDNKFHTGPLGELLESDEKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKHG
RGGQSALRFARLRMEKRHNYVRKTAELATQFFINPATSQPNVSGLILAGSADFKTELSQS
DMFDPRLQAKILNVVDVSYGGENGFSQAIELSAEILSNVKFIQEKRLIGKFFEEISQDTG
KYVFGVDDTIKALEMGAVETLVVWENLDINRSVLKNSVTNEIVIKHLNKDQETDQSNFKD
VATSAELEVQDKMPLLEWFANEYKNFGCSLEFVTNRSQEGSQFCRGFGGIGGILRYQLDM
RSFDEPSDEGELFEDSD
Download sequence
Identical sequences A0A1U8F4Z8 A0A2G3B1H9
XP_016550760.1.72714 XP_016550761.1.72714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]