SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8JUY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8JUY7
Domain Number 1 Region: 87-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.31e-18
Family Skp1 dimerisation domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 7-68
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000106
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U8JUY7
Sequence length 169
Comment (tr|A0A1U8JUY7|A0A1U8JUY7_GOSHI) SKP1-like protein 14 {ECO:0000313|RefSeq:XP_016692084.1} KW=Complete proteome; Reference proteome OX=3635 OS=Gossypium hirsutum (Upland cotton) (Gossypium mexicanum). GN=LOC107909154 OC=Gossypium.
Sequence
MSTTVPRKITLRTADNHEFEVDEAVAMELGTVKTFFDENPDATDEPIPLPNVSSKCLSTI
IEYCKLHLSLRARGNDSSSAEEEGKVYDEEMIKTHDNESLIELILAVNYLNIKDMLDTLN
QGVADRIKNKSVEYVRRFFGIENDYTPEEEAEIRAQYEWAFEGVDPDDD
Download sequence
Identical sequences A0A1U8JUY7
XP_016692084.1.88148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]