SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U9KLY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U9KLY7
Domain Number 1 Region: 20-159
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.000000000000314
Family PA0094-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U9KLY7
Sequence length 160
Comment (tr|A0A1U9KLY7|A0A1U9KLY7_9PROT) Uncharacterized protein {ECO:0000313|EMBL:AQS86803.1} KW=Complete proteome; Reference proteome OX=320497 OS=Neoasaia chiangmaiensis. GN=A0U93_01240 OC=Acetobacteraceae; Neoasaia.
Sequence
MAAAGSETLMSGTETTVSVQNMSIGCPDGWRDASMLIVTADAPSPSGVTPNIVVTREPLS
DTLPTGRVERLEEFVERQIDGMREALTDFREVARRRVTPERLTASLTIDWISEGVPVTQW
LTYAYANENTVVISTASAGRKEFSDLEFRFRSILQSFRIN
Download sequence
Identical sequences A0A1U9KLY7
WP_077805769.1.101377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]