SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U9V7Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U9V7Y4
Domain Number 1 Region: 2-219
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 2.62e-50
Family CbiG N-terminal domain-like 0.00072
Further Details:      
 
Domain Number 2 Region: 205-330
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 1.01e-31
Family CobE/GbiG C-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U9V7Y4
Sequence length 332
Comment (tr|A0A1U9V7Y4|A0A1U9V7Y4_CLOPF) Cobalamin biosynthesis protein CbiG {ECO:0000313|EMBL:AQW26769.1} KW=Complete proteome OX=1502 OS=Clostridium perfringens. GN=BXT94_08320 OC=Clostridium.
Sequence
MIGIISVTEKGDFIGDKLKDFFEENNISFKGIYKSKCEDFSLKGATQEMFETCKNIIFIS
STGIAVRAITPFIVKKDKDPGIVVVDVNNKFTISLAGGHIGGANELTLEVSKVLNNIPVI
TTATDNQNKVAPDMVAKSNNLIIEDLKKAKDMASRLVNNKKVYFLDDNNLIKLPLGYEST
YLLKDNTLWITNKEKSEEENLKGVLRLIRKNILLGVGCRKGVPSQELIDFVKYSLKDLNI
DKRAVLKIGSIDLKKEEKAILDLSEYLNCPFETFSKDEIKSVQDEFEGSDFVEKSVGVRA
VSEPAVLLMNGNIIVNKLKKNGMTLTIGELKR
Download sequence
Identical sequences A0A0H2YP19 A0A1U9V7Y4 B1R5Q4
195103.CPF_1429 WP_003456627.1.100517 WP_003456627.1.10161 WP_003456627.1.2058 WP_003456627.1.27257 WP_003456627.1.27537 WP_003456627.1.39851 WP_003456627.1.43003 WP_003456627.1.50147 gi|110798929|ref|YP_695874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]