SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U9VHI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U9VHI6
Domain Number 1 Region: 5-194
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.000000955
Family Hypothetical protein YwqG 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U9VHI6
Sequence length 209
Comment (tr|A0A1U9VHI6|A0A1U9VHI6_9RALS) Uncharacterized protein {ECO:0000313|EMBL:AQW30148.1} KW=Complete proteome OX=1944648 OS=blood disease bacterium A2-HR MARDI. GN=B0B51_09265 OC=Burkholderiaceae; Ralstonia.
Sequence
MVMLLLNTSAPDELAVQTRFGGRPLVPAQPPFAWPHCASCKQPMQFQGQIGMEASADHPA
GLLLVFMCQNDPGCCDEWEPNGGGNLALFVPATQLVLAEPPAGGLTLREACHGARTEEQD
ADDYETARRLWCQRTGNPGRQVLGQLRGTPAWLQADETPGCPACGAPMRLAAQLEEGPDA
HTAMNFGGGCGYLFQCARHAGQVKFLWQC
Download sequence
Identical sequences A0A1U9VHI6 G2ZNN9
WP_078222427.1.13478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]