SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V0LDB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1V0LDB0
Domain Number - Region: 86-147
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.00144
Family Gametocyte protein Pfg27 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V0LDB0
Sequence length 179
Comment (tr|A0A1V0LDB0|A0A1V0LDB0_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:ARD60533.1} KW=Complete proteome OX=1177180 OS=Kosakonia radicincitans DSM 16656. GN=Y71_11585 OC=Enterobacteriaceae; Kosakonia.
Sequence
MTKLTLQEQMLKAGLVTSKKMAKVQRTAKKSRVQAREAREAVEENKKAQLERDKQLSEQQ
KQAALSKEYKAQIKQLIEMNRITITKGNISFNFTDNNLIKKIEVDKVTQAQLINGRLAIA
RLVSDNNGDNPYAIIPAAVADKIAQRDANCIVLHSALTQEAQDEDDPYADFKVPDDLMW
Download sequence
Identical sequences A0A1K2AKT0 A0A1V0LDB0
WP_007371818.1.15111 WP_007371818.1.88193 WP_007371818.1.932 WP_007371818.1.93584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]