SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V0NBV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1V0NBV6
Domain Number - Region: 12-61,95-112,172-189
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0119
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V0NBV6
Sequence length 287
Comment (tr|A0A1V0NBV6|A0A1V0NBV6_LACLL) Uncharacterized protein {ECO:0000313|EMBL:ARD97399.1} KW=Complete proteome OX=1360 OS=Lactococcus lactis subsp. lactis (Streptococcus lactis). GN=LL275_pA052 OC=Lactococcus.
Sequence
MDTYRISNLNLEQEDINNLKRISTNMLDTFNHEQLLSIIDVMKNTYFMNELSTYLVDDNL
PDVGTEEFNFLVLANKYKGNIIRKIVRDEGISDYYLRKFVLKYNLTEVDKGVYIFPHKKK
DSLFIFQQKYSKAVISHETSLYLQDVIDYIPQKIQMSVPEKYNISRIQEPHENRLTSYNY
VDINSNNIMDKNIPINLVRNKSISPTQIETVNSFLGLPLRVTSIARSIVDVLKPSHKAEE
EVKEQAIKYYLERFPDNIVRLKRIAKTQNVLKELEYYLILLGVHYKL
Download sequence
Identical sequences A0A1V0NBV6 Q48615
gi|190571774|ref|YP_001966453.1|NC_010901 WP_012477749.1.96756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]