SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V2HBQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V2HBQ5
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily BH3703-like 9.15e-51
Family BH3703-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V2HBQ5
Sequence length 163
Comment (tr|A0A1V2HBQ5|A0A1V2HBQ5_BACCE) Putative antitoxin YezG {ECO:0000313|EMBL:SME45198.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BACERE00184_04994 OC=Bacillus cereus group.
Sequence
MFELELNKIYQNIAQKINDTIPVEWDIFYFNAEIYNQEGGVLFFFNTPDRSDEYIYSHDI
PDVFNVSEKEYDKTYDELFHLSVELQEIFIKNNQEPWYSFDMIVTSEGKLKIHYGYTKWY
QSTFGPNDRVDYFEYKYLGKKPSNENERRKFEEMKEYEEQNKS
Download sequence
Identical sequences A0A1J9YYS2 A0A1V2HBQ5 R8H2X2
WP_016124921.1.21643 WP_016124921.1.23100 WP_016124921.1.50770 WP_016124921.1.51656 WP_016124921.1.57245 WP_016124921.1.58328 WP_016124921.1.60153 WP_016124921.1.61231 WP_016124921.1.68562 WP_016124921.1.79252 WP_016124921.1.82421 WP_016124921.1.83070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]