SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V2LPP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V2LPP2
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000197
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 2 Region: 63-98
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0000484
Family ETX/MTX2 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V2LPP2
Sequence length 98
Comment (tr|A0A1V2LPP2|A0A1V2LPP2_PICKU) Cell division control protein 25 {ECO:0000313|EMBL:ONH75425.1} KW=Complete proteome OX=4909 OS=Pichia kudriavzevii (Yeast) (Issatchenkia orientalis). GN=BOH78_1774 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MSQKPIITAHAIRNYLPSNDLKNCLQLLQDDVVYIMDKSDNQWWDSVVLDPIGNVQRGWF
PASYTVTFTFTFTSSSKFKFKITFKFTFKIAVTVTFKF
Download sequence
Identical sequences A0A1V2LPP2
XP_020545069.1.21716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]