SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V2MC34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V2MC34
Domain Number 1 Region: 32-147
Classification Level Classification E-value
Superfamily TM1646-like 1.31e-32
Family TM1646-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V2MC34
Sequence length 148
Comment (tr|A0A1V2MC34|A0A1V2MC34_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:ONI45878.1} KW=Complete proteome; Reference proteome OX=1712378 OS=Epulopiscium sp. SCG-C07WGA-EpuloA2. GN=AN641_02950 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Epulopiscium.
Sequence
MDNIQLNKLQMPTLKELPQNKDIQSDKGFKFTLISQLNDENLQEELTKMINKISEQGSKI
SKHMDIRDIKVYRQMITEFISEVTTRSHKFSRENVLDKRGRHRVYGIVRTVNEKLDALAA
ELMRTEKNQIEILEKIGEIQGLLLDIVT
Download sequence
Identical sequences A0A1V2MC34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]