SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V2SAT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V2SAT6
Domain Number 1 Region: 4-53
Classification Level Classification E-value
Superfamily BAS1536-like 0.00000000000107
Family BAS1536-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V2SAT6
Sequence length 67
Comment (tr|A0A1V2SAT6|A0A1V2SAT6_9BACI) Uncharacterized protein {ECO:0000313|EMBL:ONK21456.1} KW=Complete proteome; Reference proteome OX=1917019 OS=Bacillus sp. VT-16-64. GN=BLX87_21565 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSIEVKNMIKKIEEKRIEMIQLGLARSFVDEGVIQLSSQLDKLLNEYEFLLKNKRAAISD
RTCRQHV
Download sequence
Identical sequences A0A1V2SAT6
WP_077113871.1.67074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]