SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V3TR13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V3TR13
Domain Number 1 Region: 5-166
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 8.5e-48
Family ChuX-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V3TR13
Sequence length 167
Comment (tr|A0A1V3TR13|A0A1V3TR13_9PAST) Heme iron utilization protein {ECO:0000313|EMBL:OOH88882.1} KW=Complete proteome; Reference proteome OX=1924934 OS=Pasteurellaceae bacterium 15-036681. GN=BMT54_08125 OC=Pasteurellaceae.
Sequence
MNTHHLLKQQISQLLDENPNIITLEIAEKLAQPEGIILTALPNEFVRVFPAERAQDILSA
ITSWGTFTTIIEKEGSIFEIKERFPSGMLGRGYYNLNMKGEEGTLHGHLKLDNIAQIAFV
SLPFRGKESYNIAFIAHNGQTIFKVYLGRDEQGQLLPHQVENFKTFQ
Download sequence
Identical sequences A0A1V3TR13
WP_077559145.1.70501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]