SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V3Y445 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V3Y445
Domain Number 1 Region: 2-330
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.01e-80
Family Mycolic acid cyclopropane synthase 0.0000269
Further Details:      
 
Weak hits

Sequence:  A0A1V3Y445
Domain Number - Region: 356-378
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0955
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V3Y445
Sequence length 393
Comment (tr|A0A1V3Y445|A0A1V3Y445_LACGS) SAM-dependent methyltransferase {ECO:0000313|EMBL:OOK98041.1} KW=Complete proteome OX=1596 OS=Lactobacillus gasseri. GN=BXT97_04020 OC=Lactobacillus.
Sequence
MLEKPLYKMMLSHSFNIPVKVTYWDGKSEVYGNGTPEVEVIFNKKIPFKDITSNASLALG
EAYMNKDLEIKGSIQQLIEAAYESSQSFMRASKFRKFLPKQKHTEKQSQEDIQSHYDIGN
DFYKLWLDPTMTYSCAYFTNGNTDDLEAAQIAKVHHILQKLDPKPGKTLLDIGCGWGTLM
LTAAKEYGLKVTGVTLSQEQFDLVNKKIKDMGLEDQAEVLLEDYRELGNRDFDYVTSVGM
FEHVGSENLGEYFKDVAKYLKPHGIALIHGITRQQGGATNAWINKYIFPGGYIPGLVEIV
SRIEEANLQIADMEMLRRHYQRTLEIWDKNFNDHRSEVEGMLGERFARMWDMYLQACAAS
FESGNIDVIQYLLTKGPSGKSLPMTRQYMLNDR
Download sequence
Identical sequences A0A1V3Y445
WP_003649041.1.1181 WP_003649041.1.14452 WP_003649041.1.48812 WP_003649041.1.99755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]