SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V3ZYI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V3ZYI1
Domain Number 1 Region: 65-203
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.000000000412
Family Hemopexin-like domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V3ZYI1
Sequence length 223
Comment (tr|A0A1V3ZYI1|A0A1V3ZYI1_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OON67901.1} KW=Complete proteome; Reference proteome OX=83656 OS=Streptomyces tsukubensis. GN=B1H18_34850 OC=Streptomyces.
Sequence
MNDAPPARITSALILPKTGGTPETAYLFQGVFAKRYIKTEHGPWQPQPASRLDCIWPQTA
KTAGALAYGAAHTYNGNIWLIRGDKATSFRPDGVPAHESKTADIFSDIRDTTFRDGITAA
SALSDTQVFLFKGSSYLRYDTRRGQTTDIKTLPHGLTPDAACWIPDSTTPTIHLYSGTDI
YTYQLDKDGTTLTPVSDHPESIFSLYADAPANRPYFTLFCCFG
Download sequence
Identical sequences A0A1V3ZYI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]