SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4ACC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4ACC8
Domain Number 1 Region: 14-216
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.22e-36
Family Hemopexin-like domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V4ACC8
Sequence length 220
Comment (tr|A0A1V4ACC8|A0A1V4ACC8_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OON81602.1} KW=Complete proteome; Reference proteome OX=83656 OS=Streptomyces tsukubensis. GN=B1H18_05380 OC=Streptomyces.
Sequence
MATDVQDSFYRRIDAVLRSRDDGNIAWVLKDANYTRYDLNADKGLTGAKPIEGNWSGLPD
SFNRRIDAALNRRDQPTVAYLFKDDQYVRWNLETDKADAGYPKTIAEGWSALPAHFQLGI
DAAVNHQDNSKIAWFFKDDQYVRYDVADNKLLAGPKSIAGNWSGLPDSFNRRIDAAVPHA
TNRNKVYLFKDDQYVRYDLAADRTDSGYPLPTRGNWSFFQ
Download sequence
Identical sequences A0A1V4ACC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]