SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4JNW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4JNW1
Domain Number 1 Region: 310-409
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000942
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V4JNW1
Sequence length 1124
Comment (tr|A0A1V4JNW1|A0A1V4JNW1_PATFA) Transient receptor potential cation channel subfamily M member 5 isoform B {ECO:0000313|EMBL:OPJ73794.1} KW=Complete proteome; Reference proteome OX=372326 OS=Patagioenas fasciata monilis. GN=AV530_013247 OC=Patagioenas.
Sequence
METKVSSSDKEEVFKRELPYCTGEIDFTASGKKRGKFIKVPSTIHPEIIFEVMLNKWKLP
APNLVVSLVGEEENFQMKPWLRDTLKKGLIKAAQSTGAWILTSALRVGVTRHLVQAVRDH
ALASTSSKVRVIAIGITSLRKIQHREILDNTKNESLVHYQSDDNIQGPLFSLEHNHSHFI
LVDHITPDEPDGTTKLRLALEKHISEQRTGYGGTGSIEIPVLCLLVNGGPGTLERICSGL
ENSAPWLILAGSGGAADILAAFINDPQLITPEAVEKQVKEKFPAESFLWKDILQWTATIQ
NIISHQHLLTLHNFEQDGSEDLDTVILKALVKACKSHSQEAQEYLDELKLAVAWNRVDIA
KSEIFNGDVEWKSCDLEEVMMDALVNDKPEFVKLFIDNGANISEFLTYSRLQRLYCSISQ
KCLLYELLLKKHEESKLTLAGLTGQQHKEQKEICPLFTLGEVSRVLKDLLHDACKGFYQD
LRHGGKKRSGQEGVASALAACKILKEMSRLETETEVARIMKEAKYEQLAVELFSECYHNS
EERAFALLVRKNQYWSKTTCLQLATEADAKSFFAHDGVQAFLTRIWWGDMSTSTQILKLI
CGFWCPLLIYTNLISFSEEKQSKNEPEPFRELDSLATERTLFFSKEEDRGNGKLEKQNPS
EKTAWATFMFTRWRKFWSAPVTVFMGNVIMYFAFLFLFTYVLLLDFKPPPPEGPSAKEII
LYFWVFTLVLEEIRQSFYTDEDTNLMKKFKQYVEDNWNKCDMVTIFLFIIGVTCRMLNST
FQAGRTILAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVT
TQALLHPDDSRVEWIFRRVLYRPYLQIFGQIPLDEIDTSRMYPRNCTFNPLQILQENSPS
CPNSYANWLVILLLVIFLLVTNVLLMNLLIAMFSYTFQVVQGNADIFWKIQRYNLIVEYH
GRPALAPPFIIINHITLVVRRIFNKMEHKKEHLERDLPVGLDQKIITWELMQKEKYLGNL
EQERKESNEERLKATSNKVDNLSKYFSGLKEQEKRFKVMEAQICYCTAVISSMAEVLTQT
NLLCNQPLSNYSCVMNANTDAPLPGRKDEECVDQSKSDITFIDN
Download sequence
Identical sequences A0A1V4JNW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]