SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V4JZ00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4JZ00
Domain Number 1 Region: 130-319
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-34
Family Nucleotide and nucleoside kinases 0.0000414
Further Details:      
 
Domain Number 2 Region: 374-562
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-32
Family Nucleotide and nucleoside kinases 0.00000324
Further Details:      
 
Domain Number 3 Region: 4-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000068
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V4JZ00
Sequence length 573
Comment (tr|A0A1V4JZ00|A0A1V4JZ00_PATFA) Adenylate kinase isoenzyme 5 {ECO:0000313|EMBL:OPJ77439.1} KW=Complete proteome; Reference proteome OX=372326 OS=Patagioenas fasciata monilis. GN=AV530_007754 OC=Patagioenas.
Sequence
MSAGEAKEYLARREIPQLFESLLNGLMCYKPDDPIEYLESCLQKVKELGGSEKVKWDTFV
SPEKKSLPPLNGGQSRRSFFRNVMPDNSNFPYRRYDRLPPIQQFSIESDTDLSETAELIE
EYDVFDPARPRPKIILVIGGPGSGKGTQSLKIAERYGFNYISVGELLRKKIHSTSSNRKW
SLIAKIITTGELAPQETTITEIKQRLMQIPDEEGIVIDGFPRDVAQAISFEDQICTPDLV
VFLACSSQRLKERLLKRAEQQGRPDDNLKATQRRLMNFKQNAVPLVKYFQEKGLIITFDA
DRDEEEVFSDISSAVDNKLFANKEAAAGPNELDCNLIMDSGDAVYTEFDFEDQEEDLSSF
SGYESTGDFSEDLRKSNIIFVVGGPGSGKGSQCEQLAKKYGFTHLSAGDLLQNELSSLSE
RSKLIKDIMECGEPVPGGIVIELMKEAMVSKLGDTRGFLIDGFPRELKEAEEFENKIGEP
KLVFCLDCSAETMSSRLLTRNQSSQRSDNAETIKEGIESYYQASKPVIAYYERKKQLCKV
DAEGRQEDVFLEVCGTIDSFLKKEEAAFSTETQ
Download sequence
Identical sequences A0A1V4JZ00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]